AFFN-DUSP7-14G9

(0)No Reviews yet
$45.00
SKU: AFFN-DUSP7-14G9-s
View product citations for antibody AFFN-DUSP7-14G9 on CiteAb

In Stock

Available: 12

DSHB Data Sheet

Catalog Fields

Antigen: Dual specificity phosphatase 7
Available to For-Profits: Yes
Antigen Species: Human
Hybridoma Cells Available (Non-Profit): No
Isotype: MIgG2b
Depositor: EU Program Affinomics
Host Species: mouse
Antigen Sequence:
Positive Tested Species Reactivity: Human
Depositors Institution: EMBL MACF
Antigen Molecular Weight: 44.9 kDa
Depositors Notes: This antibody recognizes a phosphatase that dephosphorylates both tyrosine and serine/threonine residues.
Predicted Species Reactivity: Mouse, Porcine, Rat
Human Protein Atlas:  
Immunogen: Recombinant peptide
Gene: DUSP7
Alternate Antibody Name:
Alternate Gene Names: MKP-X, PYST2
Alternate Antigen Name:
Clonality: Monoclonal
Myeloma Strain: SP2/0-AG14
Epitope Mapped: Yes
Uniprot ID: Q16829 
Epitope Location or Sequence: AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET
Entrez Gene ID: 1849 
Immunogen Sequence: a.a. 51-90
Antibody Registry ID: AB_2617541 
Recommended Applications: ELISA, Microarray
Additional Information: The N-terminal region of DUSP7 contains a Cdc25-like (CH2) domain. RRID:AB_2617541
All cell products contain the antimicrobial ProClin. Click here for additional information.
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
AFFN-DUSP7-14G9 was deposited to the DSHB by EU Program Affinomics (DSHB Hybridoma Product AFFN-DUSP7-14G9)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
The optimal Ig concentration for an application varies by species and antibody affinity. For each product, the antibody titer must be optimized for every application by the end user laboratory. A good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) when using mouse Ig is 2-5 ug/ml. For western blots, the recommended concentration range of mouse Ig 0.2-0.5 ug/ml. In general, rabbit antibodies demonstrate greater affinity and are used at a magnitude lower Ig concentration for initial testing. The recommended concentrations for rabbit Ig are 0.2-0.5 ug/ml (IF, IHC and ICC) and 20-50 ng/ml (WB).

2 References

  • Initial Publication
  • All References
  • Ratings & Reviews

    No reviews available

    Be the first to Write a Review