AFFN-DUSP7-14G9
Catalog Fields
Clone ID/Product Name: AFFN-DUSP7-14G9
Available to For-Profits: Yes
Alternate Antibody Name:
Gene Symbol: DUSP7
Ab Isotype: MIgG2b
Gene Name:
Antibody Registry ID: AB_2617541
Uniprot ID: Q16829
Entrez Gene ID: 1849
Clonality: Monoclonal
Immunogen: Recombinant peptide
Clone:
Immunogen Sequence: a.a. 51-90
Myeloma Strain: SP2/0-AG14
Epitope Mapped: Yes
Antigen Name: Dual specificity phosphatase 7
Epitope Location or Sequence: AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET
Alternate Antigen Name:
Deposit Date: 12/3/2014
Antigen Molecular Weight: 44.9 kDa
Depositor: EU Program Affinomics
Antigen Sequence:
Depositor Institution: EMBL MACF
Antigen Species: Human
Depositor Notes: This antibody recognizes a phosphatase that dephosphorylates both tyrosine and serine/threonine residues.
Host Species: mouse
Hybridoma Cells Available (Non-Profit): No
Confirmed Species Reactivity: Human
Additional Information: The N-terminal region of DUSP7 contains a Cdc25-like (CH2) domain. RRID:AB_2617541
Additional Characterization: https://cordis.europa.eu/project/id/241481/reporting
Recommended Applications: ELISA, Microarray
All cell products contain the antimicrobial ProClin. Click here for additional information.
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
AFFN-DUSP7-14G9 was deposited to the DSHB by EU Program Affinomics (DSHB Hybridoma Product AFFN-DUSP7-14G9)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
The optimal Ig concentration for an application varies by species and antibody affinity. For each product, the antibody titer must be optimized for every application by the end user laboratory. A good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) when using mouse Ig is 2-5 ug/ml. For western blots, the recommended concentration range of mouse Ig 0.2-0.5 ug/ml. In general, rabbit antibodies demonstrate greater affinity and are used at a magnitude lower Ig concentration for initial testing. The recommended concentrations for rabbit Ig are 0.2-0.5 ug/ml (IF, IHC and ICC) and 20-50 ng/ml (WB).
2 References
Initial Publication
A roadmap to generate renewable protein binders to the human proteome.
Gräslund S
Nature methods 8.7 (2011 May 15): 551-8.
ProteomeBinders: planning a European resource of affinity reagents for analysis of the human proteome.
Uhlén M
Nature methods 4.1 (2007 Jan): 13-7.