Antibody Name: CPTC-EGFR-11

Antigen:Epidermal Growth Factor Receptor Peptide 6
(0)No Reviews yet
$50.00
QuantityPrice
1 – 19$50.00
20 – 49$35.00
50 – 99$32.00
100 +$30.00
SKU: CPTC-EGFR-11-s
~ 12 μg/mL
iConcentration varies between lots. Lots are distributed in the order they are produced.

In Stock

Available: 2

Non-profit pricing: For-profit prices will be adjusted upon checkout. Click here to view for-profit pricing.

Catalog Fields
Identity
Clone ID / Antibody Name: CPTC-EGFR-11
Alternate Antibody Name: 
Antigen Name: Epidermal Growth Factor Receptor Peptide 6
Alternate Antigen Name: 
Gene Symbol: 
Gene Name: EGFR
Entrez Gene ID: 1956
Antigen Sequence: 
Antigen Species: Human
Antigen Mol. Weight: 134.2 kDa
Uniprot ID: P00533
Human Protein Atlas: 
Antibody Properties
Host Species: Rabbit
Clonality: rabbit recombinant monoclonal
Isotype: Rabbit IgG
Myeloma Strain: 240E-W2
Antibody Registry / RRID: AB_2827844
Available to For-Profits: Yes
Hybridoma Available: No
Immunogen & Epitope
Immunogen: Phosphorylated Synthetic Peptide
Immunogen Sequence: (pY)SSDPTGALTEDSIDDTFLPVPEYINQSVPK
Epitope Mapped: No
Epitope Location / Seq: Starting at amino acid 1069.
Clone: 
Additional Info: RRID: AB_2827844
Species Reactivity
Confirmed Reactivity: Human
Predicted Reactivity: 
Depositor
Depositor Name: Clinical Proteomics Technologies for Cancer
Institution: National Cancer Institute
Deposit Date: August 1, 2019
Depositor Notes: Ras Pathway
Recommended Applications
N/A for this product
Each lab must optimize concentration per application and species. Full usage recommendations →
UniProt DataUniProtP00533 ↗
Could not load UniProt data for P00533

Ratings & Reviews

No reviews available

Be the first to Write a Review