DSHB Data Sheet Tell a Friend
Antigen: AP-2 alpha Hybridoma Cells Available: No
Antigen Species: Human Depositor: Williams, T.J.
Antigen Sequence: Depositors Institution: University of Colorado, Denver
Antigen Molecular Weight: Predicted: 48kDa; Apparent: 50kDaHuman Protein Atlas:
Link
Positive Tested Species Reactivity: Chicken, Human, Mouse, ZebrafishDepositors Notes: AP-2 alpha specific. Does not react with AP-2 beta or AP-2 gamma. Immunoprecipitation also EMSA supershift analysis and ChIP-seq. Immunohistochemistry requires antigen retrieval, {see PMID: 9850080}.
Gene: TFAP2AImmunogen: AP-2 alpha delta N165
Alternate Gene Names: AP-2; BOFS; AP2TF; TFAP2; AP-2alphaImmunogen Sequence: KQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLN
Isotype: MIgG2b, kappa light chainAlternate Antibody Name:
Clonality: MonoclonalAlternate Antigen Name:
Epitope Mapped: YesMyeloma Strain: SP2/0
Epitope Location or Sequence: AP-2 alpha sequence (amino acids 166-197)Uniprot ID:
Host Species: mouseEntrez Gene ID:
Additional Characterization:
Link
Antibody Registry ID:
AB_528084
Additional Information: Recommended Applications: Chromatin Immunoprecipitation, FFPE, Gel Supershift, Immunofluorescence, Immunohistochemistry, Western Blot
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
3B5 was deposited to the DSHB by Williams, T.J. (DSHB Hybridoma Product 3B5)
All cell products contain the antimicrobial ProClin. See our FAQ section for additional information.
The indirect role of fibroblast growth factor-8 in defining neurogenic niches of the olfactory/GnRH systems.
Temporal and spatial expression of CCN3 during retina development.
Ripply3, a Tbx1 repressor, is required for development of the pharyngeal apparatus and its derivatives in mice.
AP2 transcription factor induces apoptosis in retinoblastoma cells.
A negative feedback signaling network underlies oncogene-induced senescence.
AP-2alpha transcription factor is required for early morphogenesis of the lens vesicle.
Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
Chicken transcription factor AP-2: cloning, expression and its role in outgrowth of facial prominences and limb buds.
A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.
Neural tube, skeletal and body wall defects in mice lacking transcription factor AP-2.
Nuclear to cytoplasmic shuttling of ERK promotes differentiation of muscle stem/progenitor cells.
Prdm1 functions in the mesoderm of the second heart field, where it interacts genetically with Tbx1, during outflow tract morphogenesis in the mouse embryo.
AP-2α is required after lens vesicle formation to maintain lens integrity.
Foxi transcription factors promote pharyngeal arch development by regulating formation of FGF signaling centers.
Neonatal hyperglycemia inhibits angiogenesis and induces inflammation and neuronal degeneration in the retina.
Cell delamination in the mesencephalic neural fold and its implication for the origin of ectomesenchyme.
Sfrp1 and Sfrp2 are not involved in Wnt/β-catenin signal silencing during lens induction but are required for maintenance of Wnt/β-catenin signaling in lens epithelial cells.
Alternative splicing of the chromodomain protein Morf4l1 pre-mRNA has implications on cell differentiation in the developing chicken retina.
Differential BMP signaling controls formation and differentiation of multipotent preplacodal ectoderm progenitors from human embryonic stem cells.
Inner retinal cell development is impaired in Smoky Joe chickens.
Jun is required in Isl1-expressing progenitor cells for cardiovascular development.
Forkheadbox N4 (FoxN4) triggers context-dependent differentiation in the developing chick retina and neural tube.
Directed differentiation of human pluripotent cells to neural crest stem cells.
SUMOylation of Pax7 is essential for neural crest and muscle development.
Knockdown of IKK1/2 promotes differentiation of mouse embryonic stem cells into neuroectoderm at the expense of mesoderm.
Deletion of a conserved regulatory element required for Hmx1 expression in craniofacial mesenchyme in the dumbo rat: a newly identified cause of congenital ear malformation.
Neuronal programmed cell death-1 ligand expression regulates retinal ganglion cell number in neonatal and adult mice.
Dynamic expression of ganglion cell markers in retinal progenitors during the terminal cell cycle.
Overlapping expression patterns and redundant roles for AP-2 transcription factors in the developing mammalian retina.
ΔNp63 knockout mice reveal its indispensable role as a master regulator of epithelial development and differentiation.
Disabled-1 alternative splicing in human fetal retina and neural tumors.
Identification of a Tbx1/Tbx2/Tbx3 genetic pathway governing pharyngeal and arterial pole morphogenesis.
Dual embryonic origin of the mammalian otic vesicle forming the inner ear.
Identification of a retina-specific Otx2 enhancer element active in immature developing photoreceptors.
Ptf1a/Rbpj complex inhibits ganglion cell fate and drives the specification of all horizontal cell subtypes in the chick retina.
Critical period of axoglial signaling between neuregulin-1 and brain-derived neurotrophic factor required for early Schwann cell survival and differentiation.
The transcription factors AP-2β and AP-2α are required for survival of sympathetic progenitors and differentiated sympathetic neurons.
AP2 transcription factor induces apoptosis in retinoblastoma cells.
Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
Francisella tularensis uses cholesterol and clathrin-based endocytic mechanisms to invade hepatocytes.
AP2 transcription factor induces apoptosis in retinoblastoma cells.
Transcription Factors Pax6 and AP-2alpha Interact To Coordinate Corneal Epithelial Repair by Controlling Expression of Matrix Metalloproteinase Gelatinase B.
Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
Overlapping expression patterns and redundant roles for AP-2 transcription factors in the developing mammalian retina.
Identification of a Tbx1/Tbx2/Tbx3 genetic pathway governing pharyngeal and arterial pole morphogenesis.
Ripply3, a Tbx1 repressor, is required for development of the pharyngeal apparatus and its derivatives in mice.
AP2 transcription factor induces apoptosis in retinoblastoma cells.
Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
Neural tube, skeletal and body wall defects in mice lacking transcription factor AP-2.
Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.
Nuclear to cytoplasmic shuttling of ERK promotes differentiation of muscle stem/progenitor cells.
Prdm1 functions in the mesoderm of the second heart field, where it interacts genetically with Tbx1, during outflow tract morphogenesis in the mouse embryo.
AP-2α is required after lens vesicle formation to maintain lens integrity.
Foxi transcription factors promote pharyngeal arch development by regulating formation of FGF signaling centers.
Disrupting hedgehog and WNT signaling interactions promotes cleft lip pathogenesis.
Transcription factor AP-2delta regulates the expression of polysialyltransferase ST8SIA2 in chick retina.
The indirect role of fibroblast growth factor-8 in defining neurogenic niches of the olfactory/GnRH systems.
Neonatal hyperglycemia inhibits angiogenesis and induces inflammation and neuronal degeneration in the retina.
Nel positively regulates the genesis of retinal ganglion cells by promoting their differentiation and survival during development.
Cell delamination in the mesencephalic neural fold and its implication for the origin of ectomesenchyme.
Sfrp1 and Sfrp2 are not involved in Wnt/β-catenin signal silencing during lens induction but are required for maintenance of Wnt/β-catenin signaling in lens epithelial cells.
Alternative splicing of the chromodomain protein Morf4l1 pre-mRNA has implications on cell differentiation in the developing chicken retina.
Differential BMP signaling controls formation and differentiation of multipotent preplacodal ectoderm progenitors from human embryonic stem cells.
Inner retinal cell development is impaired in Smoky Joe chickens.
Jun is required in Isl1-expressing progenitor cells for cardiovascular development.
Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
Forkheadbox N4 (FoxN4) triggers context-dependent differentiation in the developing chick retina and neural tube.
Directed differentiation of human pluripotent cells to neural crest stem cells.
SUMOylation of Pax7 is essential for neural crest and muscle development.
Knockdown of IKK1/2 promotes differentiation of mouse embryonic stem cells into neuroectoderm at the expense of mesoderm.
Deletion of a conserved regulatory element required for Hmx1 expression in craniofacial mesenchyme in the dumbo rat: a newly identified cause of congenital ear malformation.
Neuronal programmed cell death-1 ligand expression regulates retinal ganglion cell number in neonatal and adult mice.
Dynamic expression of ganglion cell markers in retinal progenitors during the terminal cell cycle.
Overlapping expression patterns and redundant roles for AP-2 transcription factors in the developing mammalian retina.
Francisella tularensis uses cholesterol and clathrin-based endocytic mechanisms to invade hepatocytes.
ΔNp63 knockout mice reveal its indispensable role as a master regulator of epithelial development and differentiation.
Disabled-1 alternative splicing in human fetal retina and neural tumors.
PTEN regulates retinal interneuron morphogenesis and synaptic layer formation.
Identification of a Tbx1/Tbx2/Tbx3 genetic pathway governing pharyngeal and arterial pole morphogenesis.
Dual embryonic origin of the mammalian otic vesicle forming the inner ear.
Temporal and spatial expression of CCN3 during retina development.
Identification of a retina-specific Otx2 enhancer element active in immature developing photoreceptors.
Ptf1a/Rbpj complex inhibits ganglion cell fate and drives the specification of all horizontal cell subtypes in the chick retina.
FGF and retinoic acid activity gradients control the timing of neural crest cell emigration in the trunk.
Critical period of axoglial signaling between neuregulin-1 and brain-derived neurotrophic factor required for early Schwann cell survival and differentiation.
The transcription factors AP-2β and AP-2α are required for survival of sympathetic progenitors and differentiated sympathetic neurons.
Ripply3, a Tbx1 repressor, is required for development of the pharyngeal apparatus and its derivatives in mice.
AP2 transcription factor induces apoptosis in retinoblastoma cells.
The early isoform of disabled-1 functions independently of Reelin-mediated tyrosine phosphorylation in chick retina.
Down regulation of pRb in cultures of avian neuroretina cells promotes proliferation of reactive Müller-like cells and emergence of retinal stem/progenitors.
Neurogenin1 effectively reprograms cultured chick retinal pigment epithelial cells to differentiate toward photoreceptors.
A negative feedback signaling network underlies oncogene-induced senescence.
Transcription Factors Pax6 and AP-2alpha Interact To Coordinate Corneal Epithelial Repair by Controlling Expression of Matrix Metalloproteinase Gelatinase B.
AP-2alpha transcription factor is required for early morphogenesis of the lens vesicle.
Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
Chicken transcription factor AP-2: cloning, expression and its role in outgrowth of facial prominences and limb buds.
A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.
Neural tube, skeletal and body wall defects in mice lacking transcription factor AP-2.
