Antibody Name: CPTC-EGFR-4

Antigen:Epidermal Growth Factor Receptor Peptide 8

(0)No Reviews yet

$50.00

Quantity	Price
1 – 19	$50.00
20 – 49	$35.00
50 – 99	$32.00
100 +	$30.00

SKU: CPTC-EGFR-4-s

Product Form :

Supernatant 1.0 ml

~ 20 μg/mL

iConcentration varies between lots. Lots are distributed in the order they are produced.

In Stock

Available: 77

Non-profit pricing: For-profit prices will be adjusted upon checkout. Click here to view for-profit pricing.

Quantity

Back

Catalog Fields

Identity

Clone ID / Antibody Name: CPTC-EGFR-4

Alternate Antibody Name: —

Antigen Name: Epidermal Growth Factor Receptor Peptide 8

Alternate Antigen Name: —

Gene Symbol: —

Gene Name: EGFR

Entrez Gene ID: 1956

Antigen Sequence: —

Antigen Species: Human

Antigen Mol. Weight: 134.2 kDa

Uniprot ID: P00533

Human Protein Atlas: —

Antibody Properties

Host Species: Mouse

Clonality: Monoclonal

Isotype: Mouse IgG1, kappa light chain

Myeloma Strain: P3x63Ag8.653

Antibody Registry / RRID: AB_2722048

Available to For-Profits: Yes

Hybridoma Available: No

Immunogen & Epitope

Immunogen: Synthetic peptide YSSDPTGALTEDSIDDTFLPVPEYINQSVPK

Immunogen Sequence: a.a. 1069-1099

Epitope Mapped: No

Epitope Location / Seq: —

Clone: —

Additional Info: RRID:AB_2722048; RAS pathway related proteins

Add. Characterization: —

Species Reactivity

Confirmed Reactivity: Human

Predicted Reactivity: —

Depositor

Depositor Name: Clinical Proteomics Technologies for Cancer

Institution: National Cancer Institute

Deposit Date: October 31, 2017

Depositor Notes: —

Recommended Applications

N/A for this product

Each lab must optimize concentration per application and species. Full usage recommendations →

UniProt DataUniProtP00533 ↗

▼

Could not load UniProt data for P00533

Back

Antibody Name: CPTC-EGFR-4

Ratings & Reviews

No reviews available