Clone ID / Name: CPTC-EPHB4-1

Anti - EPH receptor B4

(0)No Reviews yet

IF of P10 mouse cornea labeled with DSHB antibody CPTC-EPHB4-1 aginst EPH receptor B4 (red). Image credit Lachke Laboratory, University of Delaware

$50.00

Quantity discounts available

Quantity	Price
1 – 19	$50.00
20 – 49	$35.00
50 – 99	$32.00
100 +	$30.00

SKU: CPTC-EPHB4-1-s

Product Form :

Supernatant 1.0 ml

~ 10 – 20 μg/mL

iConcentration varies between lots. Lots are distributed in the order they are produced.

In Stock

Available: 38

Non-profit pricing: For-profit prices will be adjusted upon checkout. Click here to view for-profit pricing.

Quantity

Back

Catalog Fields

Identity

Clone ID / Name: CPTC-EPHB4-1

Alternate Antibody Name: —

Antigen Name: EPH receptor B4

Alternate Antigen Name: —

Gene Symbol: —

Gene Name: EPHB4

Entrez Gene ID: 2050

Antigen Sequence: —

Antigen Species: Human

Antigen Mol. Weight: 10.7 kDa

Uniprot ID: P54760

Human Protein Atlas: —

Antibody Properties

Host Species: Mouse

Clonality: Monoclonal

Isotype: MIgG2b

Myeloma Strain: P3x63Ag8.653

Antibody Registry / RRID: AB_2617253

Available to For-Profits: Yes

Hybridoma Available: No

Immunogen & Epitope

Immunogen: Recombinant Domain

Immunogen Sequence: SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD

Epitope Mapped: No

Epitope Location / Seq: —

Clone: —

Additional Info: Antibody has been characterized only by ELISA or western blot. RRID:AB_2617253

Add. Characterization: https://antibodies.cancer.gov/detail/CPTC-EPHB4-1

Species Reactivity

Confirmed Reactivity: Human, Lizard

Predicted Reactivity: —

Depositor

Depositor Name: Clinical Proteomics Technologies for Cancer

Institution: National Cancer Institute

Deposit Date: August 6, 2012

Depositor Notes: —

Recommended Applications

ELISA

Each lab must optimize concentration per application and species. Full usage recommendations →

UniProt DataUniProtP54760 ↗

▼

Could not load UniProt data for P54760

Back

Clone ID / Name: CPTC-EPHB4-1

Ratings & Reviews

No reviews available