Catalog Fields
Antigen: EPH receptor B4
Hybridoma Cells Available:
Antigen Species: Human
Depositor: Clinical Proteomics Technologies for Cancer
Isotype: MIgG2b
Antigen Sequence:
Host Species: mouse
Depositors Institution: National Cancer Institute
Positive Tested Species Reactivity: Human, Lizard
Depositors Notes:
Antigen Molecular Weight: 10.7 kDa
Human Protein Atlas:
Predicted Species Reactivity:
Gene: EPHB4
Immunogen: Recombinant Domain
Alternate Gene Names: EPH receptor B4; HTK; MYK1; Hepatoma transmembrane kinase; Tyrosine-protein kinase TYRO11; TYRO11; EC 2.7.10.1; EPHB4; ephrin type-B receptor 4; soluble EPHB4 variant 1; soluble EPHB4 variant 2; soluble EPHB4 variant 3; tyrosine-protein kinase receptor HTK; EC 2.7.10
Alternate Antibody Name:
Clonality: Monoclonal
Alternate Antigen Name:
Epitope Mapped:
Myeloma Strain: P3x63Ag8.653
Epitope Location or Sequence:
Uniprot ID: P54760
Immunogen Sequence: SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD
Antibody Registry ID: AB_2617253
Additional Information: Antibody has been characterized only by ELISA or western blot. RRID:AB_2617253
Recommended Applications: ELISA
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
CPTC-EPHB4-1 was deposited to the DSHB by Clinical Proteomics Technologies for Cancer (DSHB Hybridoma Product CPTC-EPHB4-1)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. To ensure retention of antibody activity, we recommend aliquotting the product into two parts: 1) a volume of antibody stored at 4°C to be used within two weeks. 2) the remaining product diluted with an equal volume of molecular grade glycerol and stored at -20°C.
Usage Recommendations
While optimal Ig concentration for an application will vary, a good starting concentration for immunohistochemistry (IHC), immunofluorescence(IF) and staining is 2-5 µg/ml. For Western blots, the concentration is decreased by one order of magnitude (that is, 0.2-0.5 µg/ml).
All cell products contain the antimicrobial ProClin. Click here for additional information.
1 Reference