Catalog Fields
Antigen: EPH receptor B4
Hybridoma Cells Available: No
Antigen Species: Human
Depositor: Clinical Proteomics Technologies for Cancer
Isotype: MIgG2b
Antigen Sequence:
Host Species: mouse
Depositors Institution: National Cancer Institute
Positive Tested Species Reactivity: Human, Lizard
Depositors Notes:
Predicted Species Reactivity:
Gene: EPHB4
Immunogen: Recombinant Domain
Alternate Gene Names: EPH receptor B4; HTK; MYK1; Hepatoma transmembrane kinase; Tyrosine-protein kinase TYRO11; TYRO11; EC 2.7.10.1; EPHB4; ephrin type-B receptor 4; soluble EPHB4 variant 1; soluble EPHB4 variant 2; soluble EPHB4 variant 3; tyrosine-protein kinase receptor HTK; EC 2.7.10
Alternate Antibody Name:
Clonality: Monoclonal
Alternate Antigen Name:
Epitope Mapped: No
Myeloma Strain: P3x63Ag8.653
Epitope Location or Sequence:
Uniprot ID: P54760
Immunogen Sequence: SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD
Entrez Gene ID: 2050
Additional Characterization: https://antibodies.cancer.gov/detail/CPTC-EPHB4-1
Antibody Registry ID: AB_2617253
Additional Information: Antibody has been characterized only by ELISA or western blot. RRID:AB_2617253
Recommended Applications: ELISA
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
CPTC-EPHB4-1 was deposited to the DSHB by Clinical Proteomics Technologies for Cancer (DSHB Hybridoma Product CPTC-EPHB4-1)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
The optimal Ig concentration for an application varies by species and antibody affinity. For each product, the antibody titer must be optimized for every application by the end user laboratory. A good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) when using mouse Ig is 2-5 ug/ml. For western blots, the recommended concentration range of mouse Ig 0.2-0.5 ug/ml. In general, rabbit antibodies demonstrate greater affinity and are used at a magnitude lower Ig concentration for initial testing. The recommended concentrations for rabbit Ig are 0.2-0.5 ug/ml (IF, IHC and ICC) and 20-50 ng/ml (WB).
All cell products contain the antimicrobial ProClin. Click here for additional information.
1 Reference