Antibody Name: CPTC-EPHB4-1

Antigen:EPH receptor B4
(0)No Reviews yet
$50.00
QuantityPrice
1 – 19$50.00
20 – 49$35.00
50 – 99$32.00
100 +$30.00
SKU: CPTC-EPHB4-1-s
~ 10 – 20 μg/mL
iConcentration varies between lots. Lots are distributed in the order they are produced.

In Stock

Available: 38

Non-profit pricing: For-profit prices will be adjusted upon checkout. Click here to view for-profit pricing.

Catalog Fields
Identity
Clone ID / Antibody Name: CPTC-EPHB4-1
Alternate Antibody Name: 
Antigen Name: EPH receptor B4
Alternate Antigen Name: 
Gene Symbol: 
Gene Name: EPHB4
Entrez Gene ID: 2050
Antigen Sequence: 
Antigen Species: Human
Antigen Mol. Weight: 10.7 kDa
Uniprot ID: P54760
Human Protein Atlas: 
Antibody Properties
Host Species: Mouse
Clonality: Monoclonal
Isotype: Mouse IgG2b
Myeloma Strain: P3x63Ag8.653
Antibody Registry / RRID: AB_2617253
Available to For-Profits: Yes
Hybridoma Available: No
Immunogen & Epitope
Immunogen: Recombinant Domain
Immunogen Sequence: SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD
Epitope Mapped: No
Epitope Location / Seq: 
Clone: 
Additional Info: Antibody has been characterized only by ELISA or western blot. RRID:AB_2617253
Species Reactivity
Confirmed Reactivity: Human, Lizard
Predicted Reactivity: 
Depositor
Depositor Name: Clinical Proteomics Technologies for Cancer
Institution: National Cancer Institute
Deposit Date: August 6, 2012
Depositor Notes: 
Recommended Applications
ELISA
Each lab must optimize concentration per application and species. Full usage recommendations →
UniProt DataUniProtP54760 ↗
Could not load UniProt data for P54760

Ratings & Reviews

No reviews available

Be the first to Write a Review