CPTC-EPHB4-2

(0)No Reviews yet
$50.00
QuantityPrice
1 – 19$50.00
20 – 49$35.00
50 – 99$32.00
100 +$30.00
SKU: CPTC-EPHB4-2-s

In Stock

Available: 78

DSHB Data Sheet

Catalog Fields

Product Name/ID: CPTC-EPHB4-2
Available to For-Profits: Yes
Alternate Antibody Name:
Gene Name: EPHB4
Ab Isotype: MIgG1
Gene Symbol:
Antibody Registry ID: AB_2617254 
Uniprot ID: P54760 
RRID:  
Entrez Gene ID: 2050 
Clonality: Monoclonal
Immunogen: Recombinant Domain
Clone:
Immunogen Sequence: SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD
Myeloma Strain: P3x63Ag8.653
Epitope Mapped: No
Antigen Name: EPH receptor B4
Epitope Location or Sequence:
Alternate Antigen Name:
Deposit Date: 8/6/2012
Antigen Molecular Weight: 10.7 kDa
Depositor: Clinical Proteomics Technologies for Cancer
Antigen Sequence:
Depositor Institution: National Cancer Institute
Antigen Species: Human
Depositor Notes:
Host Species: mouse
Hybridoma Cells Available (Non-Profit): No
Confirmed Species Reactivity: Human
Additional Information: Antibody has been characterized only by ELISA or western blot. RRID:AB_2617254
Predicted Species Reactivity:  
Human Protein Atlas:  
Recommended Applications: ELISA
All cell products contain the antimicrobial ProClin. Click here for additional information.
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
CPTC-EPHB4-2 was deposited to the DSHB by Clinical Proteomics Technologies for Cancer (DSHB Hybridoma Product CPTC-EPHB4-2)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
The optimal Ig concentration for an application varies by species and antibody affinity. For each product, the antibody titer must be optimized for every application by the end user laboratory. A good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) when using mouse Ig is 2-5 ug/ml. For western blots, the recommended concentration range of mouse Ig 0.2-0.5 ug/ml. In general, rabbit antibodies demonstrate greater affinity and are used at a magnitude lower Ig concentration for initial testing. The recommended concentrations for rabbit Ig are 0.2-0.5 ug/ml (IF, IHC and ICC) and 20-50 ng/ml (WB).

0 Reference

Ratings & Reviews

No reviews available

Be the first to Write a Review