CPTC-EPHB4-2

(0) No Reviews yet
$40.00
SKU: CPTC-EPHB4-2-s
View product citations for antibody CPTC-EPHB4-2 on CiteAb

In Stock

Available: 124

DSHB Data Sheet

Catalog Fields

Antigen: EPH receptor B4
Hybridoma Cells Available: No
Antigen Species: Human
Depositor: Clinical Proteomics Technologies for Cancer
Isotype: MIgG1
Antigen Sequence:
Host Species: mouse
Depositors Institution: National Cancer Institute
Positive Tested Species Reactivity: Human
Depositors Notes:
Antigen Molecular Weight: 10.7 kDa
Human Protein Atlas:  
Predicted Species Reactivity:  
Gene: EPHB4
Immunogen: Recombinant Domain
Alternate Gene Names: EPH receptor B4; HTK; MYK1; Hepatoma transmembrane kinase; Tyrosine-protein kinase TYRO11; TYRO11; EC 2.7.10.1; EPHB4; ephrin type-B receptor 4; soluble EPHB4 variant 1; soluble EPHB4 variant 2; soluble EPHB4 variant 3; tyrosine-protein kinase receptor HTK; EC 2.7.10
Alternate Antibody Name:
Clonality: Monoclonal
Alternate Antigen Name:
Epitope Mapped: No
Myeloma Strain: P3x63Ag8.653
Epitope Location or Sequence:
Uniprot ID: P54760 
Immunogen Sequence: SNAPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLD
Entrez Gene ID: 2050 
Antibody Registry ID: AB_2617254 
Additional Information: Antibody has been characterized only by ELISA or western blot. RRID:AB_2617254
Recommended Applications: ELISA
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
CPTC-EPHB4-2 was deposited to the DSHB by Clinical Proteomics Technologies for Cancer (DSHB Hybridoma Product CPTC-EPHB4-2)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
Although the optimal Ig concentration for an application varies for each product and must be optimized for each laboratory, a good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) is 2-5 ug/ml. For western blots, the recommended concentration range is 0.2-0.5 ug/ml.
All cell products contain the antimicrobial ProClin. Click here for additional information.

0 Reference

Ratings & Reviews

No reviews available

Be the first to Write a Review