CPTC-HRAS-4

(0)No Reviews yet
$50.00
QuantityPrice
1 – 19$50.00
20 – 49$35.00
50 – 99$32.00
100 +$30.00
SKU: CPTC-HRAS-4-s

In Stock

Available: 13

DSHB Data Sheet

Catalog Fields

Clone ID/Product Name: CPTC-HRAS-4
Available to For-Profits: Yes
Alternate Antibody Name:
Gene Symbol: HRAS
Ab Isotype: MIgG1
Gene Name:
Antibody Registry ID:  
Uniprot ID: P01112 
RRID:  
Entrez Gene ID: 3265 
Clonality: Monoclonal
Immunogen: Recombinant Full Length Protein
Clone:
Immunogen Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQI
Myeloma Strain: P3x63Ag8.653
Epitope Mapped: No
Antigen Name: HRas Proto-Oncogene, GTPase
Epitope Location or Sequence:
Alternate Antigen Name:
Deposit Date: 3/26/2025
Antigen Molecular Weight: 21.4 kDa
Depositor: Clinical Proteomics Technologies for Cancer
Antigen Sequence:
Depositor Institution: National Cancer Institute
Antigen Species: Human
Depositor Notes:
Host Species: mouse
Hybridoma Cells Available (Non-Profit): No
Confirmed Species Reactivity: Human
Additional Information:
Predicted Species Reactivity:  
Recommended Applications: ELISA, Immuno-MRM
All cell products contain the antimicrobial ProClin. Click here for additional information.
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
CPTC-HRAS-4 was deposited to the DSHB by Clinical Proteomics Technologies for Cancer (DSHB Hybridoma Product CPTC-HRAS-4)
Storage and Handling Recommendations
Although many cell products are maintained at 4?C for years without loss of activity, shelf-life at 4?C is highly variable. For immediate use, short term storage at 4?C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 µl for freezing at -20?C or -80?C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
Although the optimal Ig concentration for an application varies for each product and must be optimized for each laboratory, a good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) is 2-5 µg/ml. For western blots, the recommended concentration range is 0.2-0.5 µg/ml.

0 Reference

Ratings & Reviews

No reviews available

Be the first to Write a Review