Catalog Fields
Antigen: Tyrosine Kinase Non Receptor 2
Hybridoma Cells Available: No
Antigen Species: Human
Depositor: Clinical Proteomics Technologies for Cancer
Isotype: MIgG2b
Antigen Sequence:
Host Species: mouse
Depositors Institution: National Cancer Institute
Positive Tested Species Reactivity: Human
Depositors Notes:
Predicted Species Reactivity:
Gene: TNK2
Immunogen: Recombinant protein domain
Alternate Gene Names: ACK, ACK1, p21cdc42Hs
Alternate Antibody Name:
Clonality: Monoclonal
Alternate Antigen Name:
Epitope Mapped: No
Myeloma Strain: P3x63Ag8.653
Epitope Location or Sequence:
Uniprot ID: Q07912
Immunogen Sequence: SPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNP GARPPPPRATARLPQRGCPGDG (a.a. 881-952)
Entrez Gene ID: 10188
Additional Characterization: https://antibodies.cancer.gov/detail/CPTC-TNK2-3#CPTC-TNK2-3
Antibody Registry ID: AB_2877112
Additional Information:
Recommended Applications: ELISA, Western Blot
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
CPTC-TNK2-3 was deposited to the DSHB by Clinical Proteomics Technologies for Cancer (DSHB Hybridoma Product CPTC-TNK2-3)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
Although the optimal Ig concentration for an application varies for each product and must be optimized for each laboratory, a good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) is 2-5 ug/ml. For western blots, the recommended concentration range is 0.2-0.5 ug/ml.
All cell products contain the antimicrobial ProClin. Click here for additional information.
0 Reference