GABRG2-R86

(0) No Reviews yet
$40.00
SKU: GABRG2-R86-p
View product citations for antibody GABRG2-R86 on CiteAb

Please allow 4 -6 weeks for production and delivery.

DSHB Data Sheet

Catalog Fields

Antigen: Gamma-aminobutyric acid receptor subunit gamma-2
Hybridoma Cells Available: No
Antigen Species: Rat
Depositor: De Blas, Angel L.
Isotype: Rabbit IgG
Antigen Sequence:
Host Species: rabbit
Depositors Institution: University of Connecticut
Positive Tested Species Reactivity: Rat
Depositors Notes: The synthetic peptide immunogen was coupled to a carrier protein by a C-end, which was added if not present in the peptide. IP, IB (1:500)
Antigen Molecular Weight: 54.0 kDa
Human Protein Atlas:  
Predicted Species Reactivity:  
Gene: Gabrg2
Immunogen: Synthetic peptide
Alternate Gene Names:
Alternate Antibody Name:
Clonality: Polyclonal
Alternate Antigen Name:
Epitope Mapped: Yes
Myeloma Strain:
Epitope Location or Sequence: N-terminus amino acids 1-15
Uniprot ID: P18508 
Immunogen Sequence: QKSDDDYEDYASNKTWVLTPKVPEGDVTVC (Q= pyroglutamate)
Entrez Gene ID: 29709 
Additional Characterization:  
Antibody Registry ID: AB_2877081 
Additional Information: Affinity-purified antibody also validated for IHC and IF.
Recommended Applications: Immunoprecipitation, Western Blot
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
GABRG2-R86 was deposited to the DSHB by De Blas, Angel L. (DSHB Hybridoma Product GABRG2-R86)
Storage and Handling Recommendations
Usage Recommendations
All cell products contain the antimicrobial ProClin. Click here for additional information.

1 Reference

  • Initial Publication
  • WB References
  • Epitope Map References
  • All References
  • Ratings & Reviews

    No reviews available

    Be the first to Write a Review