(0) No Reviews yet
View product citations for antibody GABRG2-R86 on CiteAb

Please allow 4 -6 weeks for production and delivery.

DSHB Data Sheet

Catalog Fields

Antigen: Gamma-aminobutyric acid receptor subunit gamma-2
Hybridoma Cells Available: No
Antigen Species: Rat
Depositor: De Blas, Angel L.
Isotype: Rabbit IgG
Antigen Sequence:
Host Species: rabbit
Depositors Institution: University of Connecticut
Positive Tested Species Reactivity: Rat
Depositors Notes: The synthetic peptide immunogen was coupled to a carrier protein by a C-end, which was added if not present in the peptide. IP, IB (1:500)
Antigen Molecular Weight: 54.0 kDa
Human Protein Atlas:  
Predicted Species Reactivity:  
Gene: Gabrg2
Immunogen: Synthetic peptide
Alternate Gene Names:
Alternate Antibody Name:
Clonality: Polyclonal
Alternate Antigen Name:
Epitope Mapped: Yes
Myeloma Strain:
Epitope Location or Sequence: N-terminus amino acids 1-15
Uniprot ID: P18508 
Immunogen Sequence: QKSDDDYEDYASNKTWVLTPKVPEGDVTVC (Q= pyroglutamate)
Entrez Gene ID: 29709 
Additional Characterization:  
Antibody Registry ID: AB_2877081 
Additional Information: Affinity-purified antibody also validated for IHC and IF.
Recommended Applications: Immunoprecipitation, Western Blot
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
GABRG2-R86 was deposited to the DSHB by De Blas, Angel L. (DSHB Hybridoma Product GABRG2-R86)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
The optimal Ig concentration for an application varies by species and antibody affinity. For each product, the antibody titer must be optimized for every application by the end user laboratory. A good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) when using mouse Ig is 2-5 ug/ml. For western blots, the recommended concentration range of mouse Ig 0.2-0.5 ug/ml. In general, rabbit antibodies demonstrate greater affinity and are used at a magnitude lower Ig concentration for initial testing. The recommended concentrations for rabbit Ig are 0.2-0.5 ug/ml (IF, IHC and ICC) and 20-50 ng/ml (WB).
All cell products contain the antimicrobial ProClin. Click here for additional information.

1 Reference

  • Initial Publication
  • WB References
  • Epitope Map References
  • All References
  • Ratings & Reviews

    No reviews available

    Be the first to Write a Review