(0)No Reviews yet
View product citations for antibody GABRG2-R86 on CiteAb

Please allow 4 -6 weeks for production and delivery.

DSHB Data Sheet

Catalog Fields

Antigen: Gamma-aminobutyric acid receptor subunit gamma-2
Available to For-Profits: Yes
Antigen Species: Rat
Hybridoma Cells Available (Non-Profit): No
Isotype: Rabbit IgG
Depositor: De Blas, Angel L.
Host Species: rabbit
Antigen Sequence:
Positive Tested Species Reactivity: Rat
Depositors Institution: University of Connecticut
Antigen Molecular Weight: 54.0 kDa
Depositors Notes: The synthetic peptide immunogen was coupled to a carrier protein by a C-end, which was added if not present in the peptide. IP, IB (1:500)
Predicted Species Reactivity:  
Human Protein Atlas:  
Immunogen: Synthetic peptide
Gene: Gabrg2
Alternate Antibody Name:
Alternate Gene Names:
Alternate Antigen Name:
Clonality: Polyclonal
Myeloma Strain:
Epitope Mapped: Yes
Uniprot ID: P18508 
Epitope Location or Sequence: N-terminus amino acids 1-15
Entrez Gene ID: 29709 
Immunogen Sequence: QKSDDDYEDYASNKTWVLTPKVPEGDVTVC (Q= pyroglutamate)
Antibody Registry ID: AB_2877081 
Additional Characterization:  
Recommended Applications: Immunoprecipitation, Western Blot
Additional Information: Affinity-purified antibody also validated for IHC and IF.
All cell products contain the antimicrobial ProClin. Click here for additional information.
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
GABRG2-R86 was deposited to the DSHB by De Blas, Angel L. (DSHB Hybridoma Product GABRG2-R86)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. For immediate use, short term storage at 4°C up to two weeks is recommended. For long term storage, divide the solution into volumes of no less than 20 ul for freezing at -20°C or -80°C. The small volume aliquot should provide sufficient reagent for short term use. Freeze-thaw cycles should be avoided. For concentrate or bioreactor products, an equal volume of glycerol, a cryoprotectant, may be added prior to freezing.
Usage Recommendations
The optimal Ig concentration for an application varies by species and antibody affinity. For each product, the antibody titer must be optimized for every application by the end user laboratory. A good starting concentration for immunohistochemistry (IHC), immunofluorescence (IF), and immunocytochemistry (ICC) when using mouse Ig is 2-5 ug/ml. For western blots, the recommended concentration range of mouse Ig 0.2-0.5 ug/ml. In general, rabbit antibodies demonstrate greater affinity and are used at a magnitude lower Ig concentration for initial testing. The recommended concentrations for rabbit Ig are 0.2-0.5 ug/ml (IF, IHC and ICC) and 20-50 ng/ml (WB).

1 Reference

  • Initial Publication
  • WB References
  • Epitope Map References
  • All References
  • Ratings & Reviews

    No reviews available

    Be the first to Write a Review