Clone ID / Name: GABRG2-R86
Anti - Gamma-aminobutyric acid receptor subunit gamma-2
Catalog Fields
Identity
Clone ID / Name: GABRG2-R86
Alternate Antibody Name: —
Antigen Name: Gamma-aminobutyric acid receptor subunit gamma-2
Alternate Antigen Name: —
Gene Symbol: —
Gene Name: Gabrg2
Entrez Gene ID: 29709
Antigen Sequence: —
Antigen Species: Rat
Antigen Mol. Weight: 54.0 kDa
Uniprot ID: P18508
Human Protein Atlas: —
Antibody Properties
Host Species: Rabbit
Clonality: Polyclonal
Isotype: Rabbit IgG
Myeloma Strain: —
Antibody Registry / RRID: AB_2877081
Available to For-Profits: Yes
Hybridoma Available: No
Immunogen & Epitope
Immunogen: Synthetic peptide
Immunogen Sequence: QKSDDDYEDYASNKTWVLTPKVPEGDVTVC (Q= pyroglutamate)
Epitope Mapped: Yes
Epitope Location / Seq: N-terminus amino acids 1-15
Clone: —
Additional Info: Affinity-purified antibody also validated for IHC and IF.
Add. Characterization: —
Species Reactivity
Confirmed Reactivity: Rat
Predicted Reactivity: —
Depositor
Depositor Name: Angel L. De Blas
Institution: University of Connecticut
Deposit Date: June 2, 2019
Depositor Notes: The synthetic peptide immunogen was coupled to a carrier protein by a C-end, which was added if not present in the peptide. IP, IB (1:500)
Recommended Applications
IP
WB
Each lab must optimize concentration per application and species. Full usage recommendations →
▼
Could not load UniProt data for P18508