3B5

(0) No Reviews yet
$40.00
SKU: 3B5
View product citations for antibody 3B5 on CiteAb

In Stock

Available: 88

DSHB Data Sheet

Catalog Fields

Antigen: AP-2 alpha
Hybridoma Cells Available:
Antigen Species: Human
Depositor: Williams, T.J.
Isotype: MIgG2b, kappa light chain
Antigen Sequence:
Host Species: mouse
Depositors Institution: University of Colorado, Denver
Positive Tested Species Reactivity: Chicken, Human, Mouse, Zebrafish
Depositors Notes: AP-2 alpha specific. Does not react with AP-2 beta or AP-2 gamma. Immunoprecipitation also EMSA supershift analysis and ChIP-seq. Immunohistochemistry requires antigen retrieval, {see PMID: 9850080}.
Antigen Molecular Weight: Predicted: 48kDa; Apparent: 50kDa
Human Protein Atlas:
Predicted Species Reactivity:  
Gene: TFAP2A
Immunogen: AP-2 alpha delta N165
Alternate Gene Names: AP-2; BOFS; AP2TF; TFAP2; AP-2alpha
Alternate Antibody Name:
Clonality: Monoclonal
Alternate Antigen Name:
Epitope Mapped: Yes
Myeloma Strain: SP2/0
Epitope Location or Sequence: AP-2 alpha sequence (amino acids 166-197)
Uniprot ID: P05549 
Immunogen Sequence: KQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLN
Entrez Gene ID: 7020 
Additional Characterization:
Antibody Registry ID: AB_528084 
Additional Information:
Recommended Applications: Chromatin Immunoprecipitation, FFPE, Gel Supershift, Immunofluorescence, Immunohistochemistry, Western Blot
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
3B5 was deposited to the DSHB by Williams, T.J. (DSHB Hybridoma Product 3B5)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. To ensure retention of antibody activity, we recommend aliquotting the product into two parts: 1) a volume of antibody stored at 4°C to be used within two weeks. 2) the remaining product diluted with an equal volume of molecular grade glycerol and stored at -20°C.
Usage Recommendations
While optimal Ig concentration for an application will vary, a good starting concentration for immunohistochemistry (IHC), immunofluorescence(IF) and staining is 2-5 µg/ml. For Western blots, the concentration is decreased by one order of magnitude (that is, 0.2-0.5 µg/ml).
All cell products contain the antimicrobial ProClin. Click here for additional information.

50 References

  • Initial Publication
  • IF References
  • WB References
  • IHC References
  • FFPE References
  • Epitope Map References
  • Gel Supershift References
  • All References
  • Initial Publication
    IF References

    SUMOylation of Pax7 is essential for neural crest and muscle development.
    García-Castro MI
    Cellular and molecular life sciences : CMLS 70.10 (2013 May): 1793-806.

    AP-2α is required after lens vesicle formation to maintain lens integrity.
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 243.10 (2014 Oct): 1298-309.

    Nuclear to cytoplasmic shuttling of ERK promotes differentiation of muscle stem/progenitor cells.
    Tzahor E
    Development (Cambridge, England) 141.13 (2014 Jul): 2611-20.

    Sfrp1 and Sfrp2 are not involved in Wnt/β-catenin signal silencing during lens induction but are required for maintenance of Wnt/β-catenin signaling in lens epithelial cells.
    McAvoy JW
    Developmental biology 384.2 (2013 Dec 15): 181-93.

    Neonatal hyperglycemia inhibits angiogenesis and induces inflammation and neuronal degeneration in the retina.
    Sennlaub F
    PloS one 8.11 (2013): e79545.

    Overlapping expression patterns and redundant roles for AP-2 transcription factors in the developing mammalian retina.
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 241.4 (2012 Apr): 814-29.

    Knockdown of IKK1/2 promotes differentiation of mouse embryonic stem cells into neuroectoderm at the expense of mesoderm.
    Kaltschmidt C
    Stem cell reviews and reports 8.4 (2012 Dec): 1098-108.

    AP2 transcription factor induces apoptosis in retinoblastoma cells.
    Godbout R
    Genes, chromosomes and cancer 49.9 (2010 Sep): 819-30.

    Disabled-1 alternative splicing in human fetal retina and neural tumors.
    Godbout R
    PloS one 6.12 (2011): e28579.

    Dual embryonic origin of the mammalian otic vesicle forming the inner ear.
    Morrow BE
    Development (Cambridge, England) 138.24 (2011 Dec): 5403-14.

    Critical period of axoglial signaling between neuregulin-1 and brain-derived neurotrophic factor required for early Schwann cell survival and differentiation.
    Loeb JA
    The Journal of neuroscience : the official journal of the Society for Neuroscience 31.26 (2011 Jun 29): 9630-40.

    Dynamic expression of ganglion cell markers in retinal progenitors during the terminal cell cycle.
    Glaser T
    Molecular and cellular neurosciences 50.2 (2012 Jun): 160-8.

    Ptf1a/Rbpj complex inhibits ganglion cell fate and drives the specification of all horizontal cell subtypes in the chick retina.
    Guillonneau X
    Developmental biology 358.2 (2011 Oct 15): 296-308.

    Identification of a retina-specific Otx2 enhancer element active in immature developing photoreceptors.
    Cepko CL
    Developmental biology 360.1 (2011 Dec 1): 241-55.

    Neuronal programmed cell death-1 ligand expression regulates retinal ganglion cell number in neonatal and adult mice.
    Gordon LK
    Journal of neuro-ophthalmology : the official journal of the North American Neuro-Ophthalmology Society 32.3 (2012 Sep): 227-37.

    Identification of a Tbx1/Tbx2/Tbx3 genetic pathway governing pharyngeal and arterial pole morphogenesis.
    Christoffels VM
    Human molecular genetics 21.6 (2012 Mar 15): 1217-29.

    The transcription factors AP-2β and AP-2α are required for survival of sympathetic progenitors and differentiated sympathetic neurons.
    Rohrer H
    Developmental biology 355.1 (2011 Jul 1): 89-100.

    Deletion of a conserved regulatory element required for Hmx1 expression in craniofacial mesenchyme in the dumbo rat: a newly identified cause of congenital ear malformation.
    Turner EE
    Disease models and mechanisms 5.6 (2012 Nov): 812-22.

    ΔNp63 knockout mice reveal its indispensable role as a master regulator of epithelial development and differentiation.
    Sinha S
    Development (Cambridge, England) 139.4 (2012 Feb): 772-82.

    Prdm1 functions in the mesoderm of the second heart field, where it interacts genetically with Tbx1, during outflow tract morphogenesis in the mouse embryo.
    Buckingham M
    Human molecular genetics 23.19 (2014 Oct 1): 5087-101.

    Foxi transcription factors promote pharyngeal arch development by regulating formation of FGF signaling centers.
    Groves AK
    Developmental biology 390.1 (2014 Jun 1): 1-13.

    Differential BMP signaling controls formation and differentiation of multipotent preplacodal ectoderm progenitors from human embryonic stem cells.
    Li JY
    Developmental biology 379.2 (2013 Jul 15): 208-20.

    Jun is required in Isl1-expressing progenitor cells for cardiovascular development.
    Stoller JZ
    PloS one 8.2 (2013): e57032.

    Inner retinal cell development is impaired in Smoky Joe chickens.
    Choh V
    Poultry science 92.5 (2013 May): 1322-30.

    Forkheadbox N4 (FoxN4) triggers context-dependent differentiation in the developing chick retina and neural tube.
    Hallböök F
    Differentiation; research in biological diversity 85.1-2 (2013 Jan): 11-9.

    Alternative splicing of the chromodomain protein Morf4l1 pre-mRNA has implications on cell differentiation in the developing chicken retina.
    Hallböök F
    Journal of molecular neuroscience : MN 51.2 (2013 Oct): 615-28.

    Cell delamination in the mesencephalic neural fold and its implication for the origin of ectomesenchyme.
    Thiery JP
    Development (Cambridge, England) 140.24 (2013 Dec): 4890-902.

    Directed differentiation of human pluripotent cells to neural crest stem cells.
    Dalton S
    Nature protocols 8.1 (2013 Jan): 203-12.

    Distribution and diversity of intrinsically photosensitive retinal ganglion cells in tree shrew.
    Field GD
    The Journal of comparative neurology 527.1 (2019 Jan 1): 328-344.

    Identification of Embryonic Neural Plate Border Stem Cells and Their Generation by Direct Reprogramming from Adult Human Blood Cells.
    Trumpp A
    Cell stem cell 24.1 (2019 Jan 3): 166-182.e13.

    WB References
    IHC References

    A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.
    Hurst HC
    Oncogene 13.8 (1996 Oct 17): 1701-7.

    Neural tube, skeletal and body wall defects in mice lacking transcription factor AP-2.
    Williams T
    Nature 381.6579 (1996 May 16): 238-41.

    Chicken transcription factor AP-2: cloning, expression and its role in outgrowth of facial prominences and limb buds.
    Richman JM
    Developmental biology 188.2 (1997 Aug 15): 248-66.

    Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    AP-2alpha transcription factor is required for early morphogenesis of the lens vesicle.
    Williams T
    Developmental biology 206.1 (1999 Feb 1): 46-62.

    Temporal and spatial expression of CCN3 during retina development.
    Marx M
    Developmental neurobiology 72.11 (2012 Nov): 1363-75.

    AP2 transcription factor induces apoptosis in retinoblastoma cells.
    Godbout R
    Genes, chromosomes and cancer 49.9 (2010 Sep): 819-30.

    Ripply3, a Tbx1 repressor, is required for development of the pharyngeal apparatus and its derivatives in mice.
    Takada S
    Development (Cambridge, England) 138.2 (2011 Jan): 339-48.

    A negative feedback signaling network underlies oncogene-induced senescence.
    Cichowski K
    Cancer cell 10.6 (2006 Dec): 459-72.

    The indirect role of fibroblast growth factor-8 in defining neurogenic niches of the olfactory/GnRH systems.
    Wray S
    The Journal of neuroscience : the official journal of the Society for Neuroscience 33.50 (2013 Dec 11): 19620-34.

    FFPE References

    Neural tube, skeletal and body wall defects in mice lacking transcription factor AP-2.
    Williams T
    Nature 381.6579 (1996 May 16): 238-41.

    Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    Overlapping expression patterns and redundant roles for AP-2 transcription factors in the developing mammalian retina.
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 241.4 (2012 Apr): 814-29.

    AP2 transcription factor induces apoptosis in retinoblastoma cells.
    Godbout R
    Genes, chromosomes and cancer 49.9 (2010 Sep): 819-30.

    Identification of a Tbx1/Tbx2/Tbx3 genetic pathway governing pharyngeal and arterial pole morphogenesis.
    Christoffels VM
    Human molecular genetics 21.6 (2012 Mar 15): 1217-29.

    Ripply3, a Tbx1 repressor, is required for development of the pharyngeal apparatus and its derivatives in mice.
    Takada S
    Development (Cambridge, England) 138.2 (2011 Jan): 339-48.

    Epitope Map References
    Gel Supershift References
    All References

    A family of AP-2 proteins regulates c-erbB-2 expression in mammary carcinoma.
    Hurst HC
    Oncogene 13.8 (1996 Oct 17): 1701-7.

    Neural tube, skeletal and body wall defects in mice lacking transcription factor AP-2.
    Williams T
    Nature 381.6579 (1996 May 16): 238-41.

    Chicken transcription factor AP-2: cloning, expression and its role in outgrowth of facial prominences and limb buds.
    Richman JM
    Developmental biology 188.2 (1997 Aug 15): 248-66.

    Expression of AP-2 transcription factors in human breast cancer correlates with the regulation of multiple growth factor signalling pathways.
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    AP-2alpha transcription factor is required for early morphogenesis of the lens vesicle.
    Williams T
    Developmental biology 206.1 (1999 Feb 1): 46-62.

    Temporal and spatial expression of CCN3 during retina development.
    Marx M
    Developmental neurobiology 72.11 (2012 Nov): 1363-75.

    AP2 transcription factor induces apoptosis in retinoblastoma cells.
    Godbout R
    Genes, chromosomes and cancer 49.9 (2010 Sep): 819-30.

    Ripply3, a Tbx1 repressor, is required for development of the pharyngeal apparatus and its derivatives in mice.
    Takada S
    Development (Cambridge, England) 138.2 (2011 Jan): 339-48.

    A negative feedback signaling network underlies oncogene-induced senescence.
    Cichowski K
    Cancer cell 10.6 (2006 Dec): 459-72.

    The indirect role of fibroblast growth factor-8 in defining neurogenic niches of the olfactory/GnRH systems.
    Wray S
    The Journal of neuroscience : the official journal of the Society for Neuroscience 33.50 (2013 Dec 11): 19620-34.

    SUMOylation of Pax7 is essential for neural crest and muscle development.
    García-Castro MI
    Cellular and molecular life sciences : CMLS 70.10 (2013 May): 1793-806.

    AP-2α is required after lens vesicle formation to maintain lens integrity.
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 243.10 (2014 Oct): 1298-309.

    Nuclear to cytoplasmic shuttling of ERK promotes differentiation of muscle stem/progenitor cells.
    Tzahor E
    Development (Cambridge, England) 141.13 (2014 Jul): 2611-20.

    Sfrp1 and Sfrp2 are not involved in Wnt/β-catenin signal silencing during lens induction but are required for maintenance of Wnt/β-catenin signaling in lens epithelial cells.
    McAvoy JW
    Developmental biology 384.2 (2013 Dec 15): 181-93.

    Neonatal hyperglycemia inhibits angiogenesis and induces inflammation and neuronal degeneration in the retina.
    Sennlaub F
    PloS one 8.11 (2013): e79545.

    Overlapping expression patterns and redundant roles for AP-2 transcription factors in the developing mammalian retina.
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 241.4 (2012 Apr): 814-29.

    Knockdown of IKK1/2 promotes differentiation of mouse embryonic stem cells into neuroectoderm at the expense of mesoderm.
    Kaltschmidt C
    Stem cell reviews and reports 8.4 (2012 Dec): 1098-108.

    Disabled-1 alternative splicing in human fetal retina and neural tumors.
    Godbout R
    PloS one 6.12 (2011): e28579.

    Dual embryonic origin of the mammalian otic vesicle forming the inner ear.
    Morrow BE
    Development (Cambridge, England) 138.24 (2011 Dec): 5403-14.

    Critical period of axoglial signaling between neuregulin-1 and brain-derived neurotrophic factor required for early Schwann cell survival and differentiation.
    Loeb JA
    The Journal of neuroscience : the official journal of the Society for Neuroscience 31.26 (2011 Jun 29): 9630-40.

    Dynamic expression of ganglion cell markers in retinal progenitors during the terminal cell cycle.
    Glaser T
    Molecular and cellular neurosciences 50.2 (2012 Jun): 160-8.

    Ptf1a/Rbpj complex inhibits ganglion cell fate and drives the specification of all horizontal cell subtypes in the chick retina.
    Guillonneau X
    Developmental biology 358.2 (2011 Oct 15): 296-308.

    Identification of a retina-specific Otx2 enhancer element active in immature developing photoreceptors.
    Cepko CL
    Developmental biology 360.1 (2011 Dec 1): 241-55.

    Neuronal programmed cell death-1 ligand expression regulates retinal ganglion cell number in neonatal and adult mice.
    Gordon LK
    Journal of neuro-ophthalmology : the official journal of the North American Neuro-Ophthalmology Society 32.3 (2012 Sep): 227-37.

    Identification of a Tbx1/Tbx2/Tbx3 genetic pathway governing pharyngeal and arterial pole morphogenesis.
    Christoffels VM
    Human molecular genetics 21.6 (2012 Mar 15): 1217-29.

    The transcription factors AP-2β and AP-2α are required for survival of sympathetic progenitors and differentiated sympathetic neurons.
    Rohrer H
    Developmental biology 355.1 (2011 Jul 1): 89-100.

    Deletion of a conserved regulatory element required for Hmx1 expression in craniofacial mesenchyme in the dumbo rat: a newly identified cause of congenital ear malformation.
    Turner EE
    Disease models and mechanisms 5.6 (2012 Nov): 812-22.

    ΔNp63 knockout mice reveal its indispensable role as a master regulator of epithelial development and differentiation.
    Sinha S
    Development (Cambridge, England) 139.4 (2012 Feb): 772-82.

    Prdm1 functions in the mesoderm of the second heart field, where it interacts genetically with Tbx1, during outflow tract morphogenesis in the mouse embryo.
    Buckingham M
    Human molecular genetics 23.19 (2014 Oct 1): 5087-101.

    Foxi transcription factors promote pharyngeal arch development by regulating formation of FGF signaling centers.
    Groves AK
    Developmental biology 390.1 (2014 Jun 1): 1-13.

    Differential BMP signaling controls formation and differentiation of multipotent preplacodal ectoderm progenitors from human embryonic stem cells.
    Li JY
    Developmental biology 379.2 (2013 Jul 15): 208-20.

    Jun is required in Isl1-expressing progenitor cells for cardiovascular development.
    Stoller JZ
    PloS one 8.2 (2013): e57032.

    Inner retinal cell development is impaired in Smoky Joe chickens.
    Choh V
    Poultry science 92.5 (2013 May): 1322-30.

    Forkheadbox N4 (FoxN4) triggers context-dependent differentiation in the developing chick retina and neural tube.
    Hallböök F
    Differentiation; research in biological diversity 85.1-2 (2013 Jan): 11-9.

    Alternative splicing of the chromodomain protein Morf4l1 pre-mRNA has implications on cell differentiation in the developing chicken retina.
    Hallböök F
    Journal of molecular neuroscience : MN 51.2 (2013 Oct): 615-28.

    Cell delamination in the mesencephalic neural fold and its implication for the origin of ectomesenchyme.
    Thiery JP
    Development (Cambridge, England) 140.24 (2013 Dec): 4890-902.

    Directed differentiation of human pluripotent cells to neural crest stem cells.
    Dalton S
    Nature protocols 8.1 (2013 Jan): 203-12.

    Distribution and diversity of intrinsically photosensitive retinal ganglion cells in tree shrew.
    Field GD
    The Journal of comparative neurology 527.1 (2019 Jan 1): 328-344.

    Identification of Embryonic Neural Plate Border Stem Cells and Their Generation by Direct Reprogramming from Adult Human Blood Cells.
    Trumpp A
    Cell stem cell 24.1 (2019 Jan 3): 166-182.e13.

    Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
    Dawid IB
    Proceedings of the National Academy of Sciences of the United States of America 110.8 (2013 Feb 19): 2870-5.

    Francisella tularensis uses cholesterol and clathrin-based endocytic mechanisms to invade hepatocytes.
    Guttman JA
    Scientific reports 1. (2011): 192.

    Transcription Factors Pax6 and AP-2alpha Interact To Coordinate Corneal Epithelial Repair by Controlling Expression of Matrix Metalloproteinase Gelatinase B.
    Fini ME
    Molecular and cellular biology 24.1 (2004 Jan): 245-57.

    Transcription factor AP-2delta regulates the expression of polysialyltransferase ST8SIA2 in chick retina.
    Godbout R
    FEBS letters 588.5 (2014 Mar 3): 770-5.

    Nel positively regulates the genesis of retinal ganglion cells by promoting their differentiation and survival during development.
    Nakamoto M
    Molecular biology of the cell 25.2 (2014 Jan): 234-44.

    Neurogenin1 effectively reprograms cultured chick retinal pigment epithelial cells to differentiate toward photoreceptors.
    Wang SZ
    The Journal of comparative neurology 518.4 (2010 Feb 15): 526-46.

    Down regulation of pRb in cultures of avian neuroretina cells promotes proliferation of reactive Müller-like cells and emergence of retinal stem/progenitors.
    Saule S
    Experimental eye research 90.6 (2010 Jun): 791-801.

    PTEN regulates retinal interneuron morphogenesis and synaptic layer formation.
    Yang XJ
    Molecular and cellular neurosciences 49.2 (2012 Feb): 171-83.

    The early isoform of disabled-1 functions independently of Reelin-mediated tyrosine phosphorylation in chick retina.
    Godbout R
    Molecular and cellular biology 30.17 (2010 Sep): 4339-53.

    FGF and retinoic acid activity gradients control the timing of neural crest cell emigration in the trunk.
    Morales AV
    The Journal of cell biology 194.3 (2011 Aug 8): 489-503.

    Disrupting hedgehog and WNT signaling interactions promotes cleft lip pathogenesis.
    Trainor PA
    The Journal of clinical investigation 124.4 (2014 Apr): 1660-71.

    Ratings & Reviews

    No reviews available

    Be the first to Write a Review