3B5

(0) No Reviews yet
$40.00
SKU: 3B5
View product citations for antibody 3B5 on CiteAb

In Stock

Available: 256

DSHB Data Sheet

Catalog Fields

Antigen: AP-2 alpha
Hybridoma Cells Available:
Antigen Species: Human
Depositor: Williams, T.J.
Isotype: MIgG2b, kappa light chain
Antigen Sequence:
Host Species: mouse
Depositors Institution: University of Colorado, Denver
Positive Tested Species Reactivity: Chicken, Human, Mouse, Zebrafish
Depositors Notes: AP-2 alpha specific. Does not react with AP-2 beta or AP-2 gamma. Immunoprecipitation also EMSA supershift analysis and ChIP-seq. Immunohistochemistry requires antigen retrieval, {see PMID: 9850080}.
Antigen Molecular Weight: Predicted: 48kDa; Apparent: 50kDa
Human Protein Atlas:
Predicted Species Reactivity:  
Gene: TFAP2A
Immunogen: AP-2 alpha delta N165
Alternate Gene Names: AP-2; BOFS; AP2TF; TFAP2; AP-2alpha
Alternate Antibody Name:
Clonality: Monoclonal
Alternate Antigen Name:
Epitope Mapped: Yes
Myeloma Strain: SP2/0
Epitope Location or Sequence: AP-2 alpha sequence (amino acids 166-197)
Uniprot ID: P05549 
Immunogen Sequence: KQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLN
Entrez Gene ID: 7020 
Additional Characterization:
Antibody Registry ID: AB_528084 
Additional Information:
Recommended Applications: Chromatin Immunoprecipitation, FFPE, Gel Supershift, Immunofluorescence, Immunohistochemistry, Western Blot
These hybridomas were created by your colleagues. Please acknowledge the hybridoma contributor and the Developmental Studies Hybridoma Bank (DSHB) in the Materials and Methods of your publications. Please email the citation to us.
For your Materials & Methods section:
3B5 was deposited to the DSHB by Williams, T.J. (DSHB Hybridoma Product 3B5)
Storage and Handling Recommendations
Although many cell products are maintained at 4°C for years without loss of activity, shelf-life at 4°C is highly variable. To ensure retention of antibody activity, we recommend aliquotting the product into two parts: 1) a volume of antibody stored at 4°C to be used within two weeks. 2) the remaining product diluted with an equal volume of molecular grade glycerol and stored at -20°C.
Usage Recommendations
While optimal Ig concentration for an application will vary, a good starting concentration for immunohistochemistry (IHC), immunofluorescence(IF) and staining is 2-5 µg/ml. For Western blots, the concentration is decreased by one order of magnitude (that is, 0.2-0.5 µg/ml).
All cell products contain the antimicrobial ProClin. Click here for additional information.

50 References

  • Initial Publication
  • IF References
  • WB References
  • IHC References
  • FFPE References
  • Epitope Map References
  • Gel Supershift References
  • All References
  • Initial Publication

    Oncogene
    Hurst HC
    Oncogene 13.8 (1996 Oct 17): 1701-7.

    IF References

    Cellular and molecular life sciences : CMLS
    García-Castro MI
    Cellular and molecular life sciences : CMLS 70.10 (2013 May): 1793-806.

    Developmental dynamics : an official publication of the American Association of Anatomists
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 243.10 (2014 Oct): 1298-309.

    Development (Cambridge, England)
    Tzahor E
    Development (Cambridge, England) 141.13 (2014 Jul): 2611-20.

    Developmental biology
    McAvoy JW
    Developmental biology 384.2 (2013 Dec 15): 181-93.

    PloS one
    Sennlaub F
    PloS one 8.11 (2013): e79545.

    Developmental dynamics : an official publication of the American Association of Anatomists
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 241.4 (2012 Apr): 814-29.

    Stem cell reviews and reports
    Kaltschmidt C
    Stem cell reviews and reports 8.4 (2012 Dec): 1098-108.

    Genes, chromosomes & cancer
    Godbout R
    Genes, chromosomes & cancer 49.9 (2010 Sep): 819-30.

    PloS one
    Godbout R
    PloS one 6.12 (2011): e28579.

    Development (Cambridge, England)
    Morrow BE
    Development (Cambridge, England) 138.24 (2011 Dec): 5403-14.

    The Journal of neuroscience : the official journal of the Society for Neuroscience
    Loeb JA
    The Journal of neuroscience : the official journal of the Society for Neuroscience 31.26 (2011 Jun 29): 9630-40.

    Molecular and cellular neurosciences
    Glaser T
    Molecular and cellular neurosciences 50.2 (2012 Jun): 160-8.

    Developmental biology
    Guillonneau X
    Developmental biology 358.2 (2011 Oct 15): 296-308.

    Developmental biology
    Cepko CL
    Developmental biology 360.1 (2011 Dec 1): 241-55.

    Journal of neuro-ophthalmology : the official journal of the North American Neuro-Ophthalmology Society
    Gordon LK
    Journal of neuro-ophthalmology : the official journal of the North American Neuro-Ophthalmology Society 32.3 (2012 Sep): 227-37.

    Human molecular genetics
    Christoffels VM
    Human molecular genetics 21.6 (2012 Mar 15): 1217-29.

    Developmental biology
    Rohrer H
    Developmental biology 355.1 (2011 Jul 1): 89-100.

    Disease models & mechanisms
    Turner EE
    Disease models & mechanisms 5.6 (2012 Nov): 812-22.

    Development (Cambridge, England)
    Sinha S
    Development (Cambridge, England) 139.4 (2012 Feb): 772-82.

    Human molecular genetics
    Buckingham M
    Human molecular genetics 23.19 (2014 Oct 1): 5087-101.

    Developmental biology
    Groves AK
    Developmental biology 390.1 (2014 Jun 1): 1-13.

    Developmental biology
    Li JY
    Developmental biology 379.2 (2013 Jul 15): 208-20.

    PloS one
    Stoller JZ
    PloS one 8.2 (2013): e57032.

    Poultry science
    Choh V
    Poultry science 92.5 (2013 May): 1322-30.

    Differentiation; research in biological diversity
    Hallböök F
    Differentiation; research in biological diversity 85.1-2 (2013 Jan): 11-9.

    Journal of molecular neuroscience : MN
    Hallböök F
    Journal of molecular neuroscience : MN 51.2 (2013 Oct): 615-28.

    Development (Cambridge, England)
    Thiery JP
    Development (Cambridge, England) 140.24 (2013 Dec): 4890-902.

    Nature protocols
    Dalton S
    Nature protocols 8.1 (2013 Jan): 203-12.

    The Journal of comparative neurology
    Field GD
    The Journal of comparative neurology 527.1 (2019 Jan 1): 328-344.

    Cell stem cell
    Trumpp A
    Cell stem cell 24.1 (2019 Jan 3): 166-182.e13.

    WB References

    Cancer research
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    Proceedings of the National Academy of Sciences of the United States of America
    Dawid IB
    Proceedings of the National Academy of Sciences of the United States of America 110.8 (2013 Feb 19): 2870-5.

    Genes, chromosomes & cancer
    Godbout R
    Genes, chromosomes & cancer 49.9 (2010 Sep): 819-30.

    Scientific reports
    Guttman JA
    Scientific reports 1. (2011): 192.

    Molecular and cellular biology
    Fini ME
    Molecular and cellular biology 24.1 (2004 Jan): 245-57.

    IHC References

    Oncogene
    Hurst HC
    Oncogene 13.8 (1996 Oct 17): 1701-7.

    Nature
    Williams T
    Nature 381.6579 (1996 May 16): 238-41.

    Developmental biology
    Richman JM
    Developmental biology 188.2 (1997 Aug 15): 248-66.

    Cancer research
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    Developmental biology
    Williams T
    Developmental biology 206.1 (1999 Feb 1): 46-62.

    Developmental neurobiology
    Marx M
    Developmental neurobiology 72.11 (2012 Nov): 1363-75.

    Genes, chromosomes & cancer
    Godbout R
    Genes, chromosomes & cancer 49.9 (2010 Sep): 819-30.

    Development (Cambridge, England)
    Takada S
    Development (Cambridge, England) 138.2 (2011 Jan): 339-48.

    Cancer cell
    Cichowski K
    Cancer cell 10.6 (2006 Dec): 459-72.

    The Journal of neuroscience : the official journal of the Society for Neuroscience
    Wray S
    The Journal of neuroscience : the official journal of the Society for Neuroscience 33.50 (2013 Dec 11): 19620-34.

    FFPE References

    Nature
    Williams T
    Nature 381.6579 (1996 May 16): 238-41.

    Cancer research
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    Developmental dynamics : an official publication of the American Association of Anatomists
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 241.4 (2012 Apr): 814-29.

    Genes, chromosomes & cancer
    Godbout R
    Genes, chromosomes & cancer 49.9 (2010 Sep): 819-30.

    Human molecular genetics
    Christoffels VM
    Human molecular genetics 21.6 (2012 Mar 15): 1217-29.

    Development (Cambridge, England)
    Takada S
    Development (Cambridge, England) 138.2 (2011 Jan): 339-48.

    Epitope Map References

    Oncogene
    Hurst HC
    Oncogene 13.8 (1996 Oct 17): 1701-7.

    Cancer research
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    Gel Supershift References

    FEBS letters
    Godbout R
    FEBS letters 588.5 (2014 Mar 3): 770-5.

    All References

    Oncogene
    Hurst HC
    Oncogene 13.8 (1996 Oct 17): 1701-7.

    Nature
    Williams T
    Nature 381.6579 (1996 May 16): 238-41.

    Developmental biology
    Richman JM
    Developmental biology 188.2 (1997 Aug 15): 248-66.

    Cancer research
    Williams T
    Cancer research 58.23 (1998 Dec 1): 5466-72.

    Developmental biology
    Williams T
    Developmental biology 206.1 (1999 Feb 1): 46-62.

    Developmental neurobiology
    Marx M
    Developmental neurobiology 72.11 (2012 Nov): 1363-75.

    Genes, chromosomes & cancer
    Godbout R
    Genes, chromosomes & cancer 49.9 (2010 Sep): 819-30.

    Development (Cambridge, England)
    Takada S
    Development (Cambridge, England) 138.2 (2011 Jan): 339-48.

    Cancer cell
    Cichowski K
    Cancer cell 10.6 (2006 Dec): 459-72.

    The Journal of neuroscience : the official journal of the Society for Neuroscience
    Wray S
    The Journal of neuroscience : the official journal of the Society for Neuroscience 33.50 (2013 Dec 11): 19620-34.

    Cellular and molecular life sciences : CMLS
    García-Castro MI
    Cellular and molecular life sciences : CMLS 70.10 (2013 May): 1793-806.

    Developmental dynamics : an official publication of the American Association of Anatomists
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 243.10 (2014 Oct): 1298-309.

    Development (Cambridge, England)
    Tzahor E
    Development (Cambridge, England) 141.13 (2014 Jul): 2611-20.

    Developmental biology
    McAvoy JW
    Developmental biology 384.2 (2013 Dec 15): 181-93.

    PloS one
    Sennlaub F
    PloS one 8.11 (2013): e79545.

    Developmental dynamics : an official publication of the American Association of Anatomists
    West-Mays JA
    Developmental dynamics : an official publication of the American Association of Anatomists 241.4 (2012 Apr): 814-29.

    Stem cell reviews and reports
    Kaltschmidt C
    Stem cell reviews and reports 8.4 (2012 Dec): 1098-108.

    PloS one
    Godbout R
    PloS one 6.12 (2011): e28579.

    Development (Cambridge, England)
    Morrow BE
    Development (Cambridge, England) 138.24 (2011 Dec): 5403-14.

    The Journal of neuroscience : the official journal of the Society for Neuroscience
    Loeb JA
    The Journal of neuroscience : the official journal of the Society for Neuroscience 31.26 (2011 Jun 29): 9630-40.

    Molecular and cellular neurosciences
    Glaser T
    Molecular and cellular neurosciences 50.2 (2012 Jun): 160-8.

    Developmental biology
    Guillonneau X
    Developmental biology 358.2 (2011 Oct 15): 296-308.

    Developmental biology
    Cepko CL
    Developmental biology 360.1 (2011 Dec 1): 241-55.

    Journal of neuro-ophthalmology : the official journal of the North American Neuro-Ophthalmology Society
    Gordon LK
    Journal of neuro-ophthalmology : the official journal of the North American Neuro-Ophthalmology Society 32.3 (2012 Sep): 227-37.

    Human molecular genetics
    Christoffels VM
    Human molecular genetics 21.6 (2012 Mar 15): 1217-29.

    Developmental biology
    Rohrer H
    Developmental biology 355.1 (2011 Jul 1): 89-100.

    Disease models & mechanisms
    Turner EE
    Disease models & mechanisms 5.6 (2012 Nov): 812-22.

    Development (Cambridge, England)
    Sinha S
    Development (Cambridge, England) 139.4 (2012 Feb): 772-82.

    Human molecular genetics
    Buckingham M
    Human molecular genetics 23.19 (2014 Oct 1): 5087-101.

    Developmental biology
    Groves AK
    Developmental biology 390.1 (2014 Jun 1): 1-13.

    Developmental biology
    Li JY
    Developmental biology 379.2 (2013 Jul 15): 208-20.

    PloS one
    Stoller JZ
    PloS one 8.2 (2013): e57032.

    Poultry science
    Choh V
    Poultry science 92.5 (2013 May): 1322-30.

    Differentiation; research in biological diversity
    Hallböök F
    Differentiation; research in biological diversity 85.1-2 (2013 Jan): 11-9.

    Journal of molecular neuroscience : MN
    Hallböök F
    Journal of molecular neuroscience : MN 51.2 (2013 Oct): 615-28.

    Development (Cambridge, England)
    Thiery JP
    Development (Cambridge, England) 140.24 (2013 Dec): 4890-902.

    Nature protocols
    Dalton S
    Nature protocols 8.1 (2013 Jan): 203-12.

    The Journal of comparative neurology
    Field GD
    The Journal of comparative neurology 527.1 (2019 Jan 1): 328-344.

    Cell stem cell
    Trumpp A
    Cell stem cell 24.1 (2019 Jan 3): 166-182.e13.

    Proceedings of the National Academy of Sciences of the United States of America
    Dawid IB
    Proceedings of the National Academy of Sciences of the United States of America 110.8 (2013 Feb 19): 2870-5.

    Scientific reports
    Guttman JA
    Scientific reports 1. (2011): 192.

    Molecular and cellular biology
    Fini ME
    Molecular and cellular biology 24.1 (2004 Jan): 245-57.

    FEBS letters
    Godbout R
    FEBS letters 588.5 (2014 Mar 3): 770-5.

    Molecular biology of the cell
    Nakamoto M
    Molecular biology of the cell 25.2 (2014 Jan): 234-44.

    The Journal of comparative neurology
    Wang SZ
    The Journal of comparative neurology 518.4 (2010 Feb 15): 526-46.

    Experimental eye research
    Saule S
    Experimental eye research 90.6 (2010 Jun): 791-801.

    Molecular and cellular neurosciences
    Yang XJ
    Molecular and cellular neurosciences 49.2 (2012 Feb): 171-83.

    Molecular and cellular biology
    Godbout R
    Molecular and cellular biology 30.17 (2010 Sep): 4339-53.

    The Journal of cell biology
    Morales AV
    The Journal of cell biology 194.3 (2011 Aug 8): 489-503.

    The Journal of clinical investigation
    Trainor PA
    The Journal of clinical investigation 124.4 (2014 Apr): 1660-71.

    Ratings & Reviews

    No reviews available

    Be the first to Write a Review